| Save | Compare | ID | Name | Sequence | Length | Level PepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | Mass | Structure | Quality PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | DBs | Primary evidence |
|---|---|---|---|---|---|---|---|---|---|---|---|
| PEPDIA-INT-036958 | Vasoactive intestinal peptide, VIP | HSDAVFTDNYTRLRKQMAVKKYLNSILN | 28 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 3326.8 Da | Linear | 85 |
| 9 |
| - |
| PEPDIA-INT-010782 | Enfuvirtide, ENF, T-20, Fuzeon, DP-178 | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF | 36 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 4450.9 Da | Linear | 85PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 9 | - |
| PEPDIA-INT-008079 | Sequence 35 from Patent US 10351599 | CYFQNCPRG | 9 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | - | Cyclic | 75PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 5 | 14 records1 papers4 negative |
| PEPDIA-INT-038027 | Angiotensin II | DRVYIHPF | 8 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 1046.2 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | 8 records2 papers1 negative5 complex |
| PEPDIA-INT-005427 | Oxytocin | CYIQNCPLG | 9 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | - | Cyclic | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | 20 records1 papers8 negative |
| PEPDIA-INT-003414 | Endothelin-1 | CSCSSLMDKECVYFCHLDIIW | 21 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 2496.0 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | - |
| PEPDIA-INT-058191 | Insulin A chain | GIVEQCCASVCSLYQLENYCN | 21 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 2339.7 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | - |
| PEPDIA-INT-075943 | Glucagon | HSQGTFTSDYSKYLDSRRAQDFVQWLMNT | 29 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 3482.8 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 4 | - |
| PEPDIA-INT-026117 | Salmon Calcitonin | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP | 32 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 3434.9 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 2 | - |
| PEPDIA-INT-044476 | Human calcitonin | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP | 32 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 3420.9 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | - |
| PEPDIA-INT-075806 | Nesiritide | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH | 32 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | - | Cyclic | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | - |
| PEPDIA-INT-066588 | Teriparatide | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | 34 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 4117.8 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | - |
| PEPDIA-INT-002864 | Exendin-4 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | 39 | GoldPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 4187.6 Da | Linear | 70PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | - |
| PEPDIA-INT-032180 | Spaglumic acid | DE | 2 | SilverPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 262.2 Da | Linear | 65PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 3 | - |
| PEPDIA-INT-068621 | Leuprolide | PHWSYLLR | 8 | SilverPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 1071.3 Da | Linear | 65PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 2 | - |
| PEPDIA-INT-021088 | Bivalirudin | FPRPGGGGNGDFEEIPEEYL | 20 | SilverPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 2180.3 Da | Linear | 65PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 2 | - |
| PEPDIA-INT-017934 | Sinapultide | KLLLLKLLLLKLLLLKLLLLK | 21 | SilverPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 2469.4 Da | Linear | 65PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 2 | - |
| PEPDIA-INT-014824 | Dasiglucagon | HSQGTFTSDYSKYLDXARAEEFVKWLEST | 29 | SilverPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | - | Linear | 65PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 2 | - |
| PEPDIA-INT-082502 | Teduglutide | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD | 33 | SilverPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | 3752.1 Da | Linear | 65PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 2 | - |
| PEPDIA-INT-015626 | Vosoritide | PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC | 39 | SilverPepDiana tier derived from the internal quality score plus activity and literature coverage; it is not an external database rating. | - | Cyclic | 65PepDiana 0–100 composite of sequence, source, activity, literature, and cross-database evidence completeness. | 2 | - |
