Record tools

Copy identifiers or export this single peptide record for a local research note.

PEPDIA-INT-010782

Gold

Enfuvirtide, ENF, T-20, Fuzeon, DP-178

Quality

Source DBs

Activities

Source refs

Literature

Patents

Integrated record

Sequence and molecular profile

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

Indexed sequence36 aa

1YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

Length

Molecular weight

4450.89 Da

Formula

C202H298N50O64

Structure type

Linear

Synthesis

Synthetic

Chirality

Family

Gene

Residue composition

Physicochemical profile

Hydrophobic14

Membrane affinity proxy

Polar12

Solubility proxy

Charged10

Net charge proxy -4

Aromatic6

Binding interaction proxy

Versioned scientific descriptors

Physicochemical properties and standard representations

calculated sequence and structure

Reported properties

Legacy compatibility fields are materialized from the versioned PepDiana computed release; no separate source-reported property is available.

Computed properties

physchem-20260620

Molecular weight

4450.8237 Da

Molecular formula

C202H298N50O64

Theoretical pI

4.3007

Net charge at pH 7

-5.1377

GRAVY

-0.875

Instability index

62.65

Aromaticity

0.1389

Topological polar surface area

1894.02 Å²

cLogP

-14.9565

Hydrogen-bond donors

Hydrogen-bond acceptors

Rotatable bonds

150

Method: PepDiana sequence/structure descriptor pipeline

Tool: Biopython+RDKit · Biopython 1.85; RDKit 2024.09.6

Calculated: 2026-06-20T11:01:38.358971+00:00

Assumptions: ph=7; termini=free N-terminus and free C-terminus for simple linear peptides; stereochemistry=standard L-amino acids; smiles_length_limit=200

Sequence representations

representations-20260620 · RDKit 2024.09.6

ProForma 2.0

validated simple linear

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

HELM 2.0

validated simple linear

PEPTIDE1{Y.T.S.L.I.H.S.L.I.E.E.S.Q.N.Q.Q.E.K.N.E.Q.E.L.L.E.L.D.K.W.A.S.L.W.N.W.F}$$$$V2.0

Canonical SMILES

validated

CCC(C)C(NC(=O)C(CC(C)C)NC(=O)C(CO)NC(=O)C(Cc1c[nH]cn1)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(CO)NC(=O)C(NC(=O)C(N)Cc1ccc(O)cc1)C(C)O)C(C)CC)C(=O)NC(CCC(=O)O)C(=O)NC(CCC(=O)O)C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CC(N)=O)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(=O)O)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NC(CCC(=O)O)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(=O)O)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(CCC(=O)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)O)C(=O)NC(CCCCN)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(C)C(=O)NC(CO)C(=O)NC(CC(C)C)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CC(N)=O)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(Cc1ccccc1)C(=O)O

Isomeric SMILES

validated

CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccccc1)C(=O)O

Follow-up research

External analysis tools

Run BLASTPSearch similar protein or peptide sequences at NCBI.Search UniProtLook for related UniProtKB entries using the sequence.Search PubMedFind literature context for this peptide record.Search PubChemOpen chemistry search with the canonical SMILES string.

Links open third-party resources with the current PepDiana sequence, record name, or chemistry notation as the initial query.

Research workflow

Citation and local history

BibTeX

@misc{PEPDIA-INT-010782,
  title = {Enfuvirtide, ENF, T-20, Fuzeon, DP-178},
  author = {{PepDiana Consortium}},
  year = {2026},
  howpublished = {PepDiana Multifunctional Peptide Database},
  url = {http://127.0.0.1:3004/peptides/PEPDIA-INT-010782},
  note = {Accessed from local PepDiana development build}
}

APA-style note

Enfuvirtide, ENF, T-20, Fuzeon, DP-178. (2026). PepDiana record PEPDIA-INT-010782. PepDiana Multifunctional Peptide Database. http://127.0.0.1:3004/peptides/PEPDIA-INT-010782

This record is saved to local recent-view history so it can reappear on the peptide browser page.

Integrated source-database annotations

Biological activity (72 records)

Stable record	Activity	Subtype	Value	Target	Assay method	Source
CTPDB_P010782_ACT_avpdb_0000	Antiviral	General Antiviral	High	Feline leukemia virus	ELISA	AVPdb_AVP1136avpdb / unavailable
CTPDB_P010782_ACT_camp_0008	Antiviral	-	Not available in the current structured import	Unknown	Not reported by source	CAMPSQ11362camp / linked
CTPDB_P010782_ACT_dbaasp_0009	Antimicrobial	-	0.006 µg/ml	HIV-1 IIIB	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0010	Antimicrobial	-	0.05 µg/ml	HIV-1 098	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0011	Antimicrobial	-	0.526 µg/ml	HIV-1 098-T20	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0012	Antimicrobial	-	54.958 µg/ml	HIV-1 098-T1249	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0013	Antimicrobial	-	47.822 µg/ml	HIV-1 098-T651	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0014	Antimicrobial	-	0.015±0.001 µM	HIV-1 NL4-3	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0015	Antimicrobial	-	0.0024±0.0006 µM	HIV-1 NL4-3 D36G	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0016	Antimicrobial	-	0.023±0.008 µM	HIV-1 NL4-3 D36G/V38A	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0017	Antimicrobial	-	0.049±0.01 µM	HIV-1 NL4-3 D36G/N43D	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0018	Antimicrobial	-	0.084±0.016 µM	HIV-1 NL4-3 D36G/N43D/S138A	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0019	Antimicrobial	-	0.0034±0.0006 µM	HIV-1 NL4-3 D36G/N126K	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0020	Antimicrobial	-	0.39±0.155 µM	HIV-1 NL4-3 DelV4/D36G/I37K/N126K/L204I	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0021	Antimicrobial	-	0.0024±0.0006 µM	HIV-1	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0022	Antimicrobial	-	0.023±0.0082 µM	HIV-1 NL4-3 V38A	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0023	Antimicrobial	-	0.049±0.01 µM	HIV-1 NL4-3 N43D	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0024	Antimicrobial	-	0.084±0.016 µM	HIV-1 NL4-3 N43D/S138A	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0025	Antimicrobial	-	0.0718 µM	HIV-1 IIIB	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0026	Antimicrobial	-	0.091 µM	HIV-1 IIIB	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0027	Antimicrobial	-	0.0705 µM	HIV-1 BaL	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0028	Antimicrobial	-	0.0204-0.0462 µM	HIV-1	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0029	Antimicrobial	-	0.0071-0.0293 µM	HIV-1 PsV	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0030	Antimicrobial	-	0.0553 µM	HIV-1 9489	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0031	Antimicrobial	-	>0.5 µM	HIV-1 NL4-3 V38A	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0032	Antimicrobial	-	0.00253 µM	HIV-1	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0033	Antimicrobial	-	0.118 µM	HIV-1 IIIB	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0034	Antimicrobial	-	0.02297 µM	HIV-1 IIIB	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0035	Antimicrobial	-	0.01643 µM	HIV-1 BaL	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0036	Antimicrobial	-	0.0129-0.0422 µM	HIV-1	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0037	Antimicrobial	-	0.0266-0.055 µM	HIV-1 PsV	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0038	Antimicrobial	-	>0.5 µM	HIV-1 NL4-3 V38A	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0039	Antimicrobial	-	>0.5 µM	HIV-1 NL4-3 D36G	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0040	Antimicrobial	-	0.37 µg/ml	HIV-1 NL4-3	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0041	Antimicrobial	-	0.09 µg/ml	HIV-1 JRCSF	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0042	Antimicrobial	-	0.02-3.58 µg/ml	HIV-1 PsV	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0043	Antimicrobial	-	0.341508 µM	HIV-2 ROD	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0044	Antimicrobial	-	0.630633 µM	HIV-2	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0045	Antimicrobial	-	0.03473667 µM	HIV-1 PsV	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0046	Antimicrobial	-	0.05302764 µM	HIV-1 NL4-3	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0047	Antimicrobial	-	0.00446808 µM	HIV-1 JRCSF	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0048	Antimicrobial	-	0.008564 µM	HIV-1 NL4-3 D36G	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0049	Antimicrobial	-	0.169333 µM	HIV-1 NL4-3	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0050	Antimicrobial	-	0.317333-7.901 µM	HIV-1 NL4-3	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0051	Antimicrobial	-	0.00863144 µM	HIV-1	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0052	Antimicrobial	-	0.53433-0.915516 µM	Simian immunodeficiency virus (SIV)	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0053	Antimicrobial	-	0.0259051 µM	HIV-1 HxB2	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0054	Antimicrobial	-	0.008564 µM	HIV-1 NL4-3 D36G PsV	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0055	Antimicrobial	-	0.04738667 µM	HIV-1 NL4-3	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0056	Antimicrobial	-	0.00296833 µM	HIV-1 JRCSF	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0057	Antimicrobial	-	0.00116333-0.031310 µM	HIV-1	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0058	Antimicrobial	-	0.02995009 µM	HIV-1	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0059	Anticancer	Cytotoxic	148.73 µM	Human adenocarcinoma TZM-bl	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dbaasp_0060	Anticancer	Cytotoxic	167.25 µM	Human T cell leukemia MT-4	Not reported by source	DBAASPS_6056_chain0dbaasp / linked
CTPDB_P010782_ACT_dramp_0061	Antimicrobial	-	Not available in the current structured import	Unknown	Not reported by source	DRAMP15987dramp / linked
CTPDB_P010782_ACT_dramp_0062	Antiviral	-	Not available in the current structured import	Unknown	Not reported by source	DRAMP15987dramp / linked
CTPDB_P010782_ACT_dramp_0063	Antiviral	Anti-HIV	Not available in the current structured import	Unknown	Not reported by source	DRAMP18181dramp / linked
CTPDB_P010782_ACT_hipdb_0005	Antiviral	Anti-HIV	High	HIV	Not reported by source	HIPdb_HIP1087hipdb / unavailable
CTPDB_P010782_ACT_hipdb_0001	Antiviral	Anti-HIV	222.0 nM	HIV	Not reported by source	HIPdb_HIP1118hipdb / unavailable
CTPDB_P010782_ACT_hipdb_0003	Antiviral	Anti-HIV	0.6 ng/ml	HIV	Not reported by source	HIPdb_HIP876hipdb / unavailable
CTPDB_P010782_ACT_hipdb_0002	Antiviral	Anti-HIV	Medium	HIV	Not reported by source	HIPdb_HIP877hipdb / unavailable
CTPDB_P010782_ACT_hipdb_0004	Antiviral	Anti-HIV	2.4±0.6 nM(fold)	HIV	Not reported by source	HIPdb_HIP878hipdb / unavailable
CTPDB_P010782_ACT_hipdb_0006	Antiviral	Anti-HIV	0.05 μg/ml	HIV	Not reported by source	HIPdb_HIP879hipdb / unavailable
CTPDB_P010782_ACT_hipdb_0007	Antiviral	Anti-HIV	95.0%	HIV	Not reported by source	HIPdb_HIP958hipdb / unavailable
CTPDB_P010782_ACT_peptherdia_0064	Clinical / Approved Drug	General Therapeutic	Not available in the current structured import	Unknown	Not reported by source	22peptherdia / linked
CTPDB_P010782_ACT_satpdb_0065	Antiviral	-	Not available in the current structured import	Unknown	Not reported by source	satpdb10220satpdb / linked
CTPDB_P010782_ACT_satpdb_0066	Antimicrobial	-	Not available in the current structured import	Unknown	Not reported by source	satpdb10220satpdb / linked
CTPDB_P010782_ACT_thpdb_0067	Clinical / Approved Drug	General Therapeutic	Not available in the current structured import	Unknown	Not reported by source	Th1088_10478_rec0thpdb / unavailable
CTPDB_P010782_ACT_thpdb_0068	Clinical / Approved Drug	General Therapeutic	Not available in the current structured import	Unknown	Not reported by source	Th1088_10479_rec1thpdb / unavailable
CTPDB_P010782_ACT_thpdb_0069	Clinical / Approved Drug	General Therapeutic	Not available in the current structured import	Unknown	Not reported by source	Th1088_10480_rec2thpdb / unavailable
CTPDB_P010782_ACT_topicalpdb_0070	Wound Healing	Skin Penetrating	Not available in the current structured import	Unknown	Induced a 50% inhibition of HIV-1JRCSF genomic integration in leukocytes residing within the vaginal epithelium (IC50) was 0.153 microM (0.687 ng/ml; 95% confidence interval, 0.563 to 0.84 ng/ml; n=7 independent experiments with 4 donor tissues.; Real-time PCR; ex vivo	1109topicalpdb / linked
CTPDB_P010782_ACT_topicalpdb_0071	Wound Healing	Skin Penetrating	Not available in the current structured import	Unknown	IC50 of 51.2 microM (230 ng/ml; 95% confidence interval, 198 to 267 ng/ml; n 8 independent experiments with 4 donor tissues); Real-time PCR; ex vivo	1110topicalpdb / linked

Provenance

Source database records (19)

Source-specific sequence or modification context. One or more source records use a sequence notation that differs from the canonical backbone. Open each raw sequence before interpreting stereochemistry, terminal groups, or non-standard residues.

avpdb

AVPdb_AVP1136

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

hipdb

HIPdb_HIP1118

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

hipdb

HIPdb_HIP877

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

hipdb

HIPdb_HIP876

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

hipdb

HIPdb_HIP878

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

hipdb

HIPdb_HIP1087

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

hipdb

HIPdb_HIP879

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

hipdb

HIPdb_HIP958

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

camp

CAMPSQ11362

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

dbaasp

DBAASPS_6056_chain0

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

dramp

DRAMP15987

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

dramp

DRAMP18181

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

peptherdia

Raw sequence

Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

satpdb

satpdb10220

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

thpdb

Th1088_10478_rec0

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

thpdb

Th1088_10479_rec1

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

thpdb

Th1088_10480_rec2

Raw sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

topicalpdb

1109

Raw sequence

YTSLIHSLIEESQNQQ EKNEQELLELDKWAS LWNWF

topicalpdb

1110

Raw sequence

YTSLIHSLIEESQNQQ EKNEQELLELDKWAS LWNWF

Citation trail

Literature (21 records)

In vitro inhibition of feline leukaemia virus infection by synthetic peptides derived from the transmembrane domain.

Boenzli E, Robert-Tissot C, Sabatino G, Cattori V, Meli ML, Gutte B, Rovero P, Flynn N, Hofmann-Lehmann R, Lutz H.

Antivir Ther2011PMID 21900723

{"pubmed_id": "22235115.0", "paper": "Trimeric, coiled-coil extension on peptide fusion inhibitor of HIV-1 influences selection of resistance pathways.", "authors": "Zhuang M, Wang W, De Feo CJ, Vassell R, Weiss CD.", "reference": "J Biol Chem. 2012 Mar 9;287(11):8297-309. Epub 2012 Jan 10."}

{"pubmed_id": "22235115.0", "paper": "Trimeric, coiled-coil extension on peptide fusion inhibitor of HIV-1 influences selection of resistance pathways.", "authors": "Zhuang M, Wang W, De Feo CJ, Vassell R, Weiss CD.", "reference": "J Biol Chem. 2012 Mar 9;287(11):8297-309. Epub 2012 Jan 10."}

{"pubmed_id": "US7919101", "paper": "Highly potent synergistic combinations of human immunodeficiency virus (HIV) fusion inhibitors", "authors": "Shibo Jiang, Chungen Pan", "reference": "New York Blood Center"}

{"pubmed_id": "US7919101", "paper": "Highly potent synergistic combinations of human immunodeficiency virus (HIV) fusion inhibitors", "authors": "Shibo Jiang, Chungen Pan", "reference": "New York Blood Center"}

{"pubmed_id": "US6861059", "paper": "Methods and compositions for treatment of HIV-1 infection using antiviral compounds in simultaneous or sequential combinations", "authors": "M. Ross Johnson, Dennis Michael Lambert", "reference": "Trimeris, Inc."}

{"pubmed_id": "US6861059", "paper": "Methods and compositions for treatment of HIV-1 infection using antiviral compounds in simultaneous or sequential combinations", "authors": "M. Ross Johnson, Dennis Michael Lambert", "reference": "Trimeris, Inc."}

{"pubmed_id": "19073606.0", "paper": "Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.", "authors": "Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.", "reference": "J Biol Chem. 2009 Feb 20;284(8):4914-20. Epub 2008 Dec 10."}

{"pubmed_id": "19073606.0", "paper": "Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.", "authors": "Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.", "reference": "J Biol Chem. 2009 Feb 20;284(8):4914-20. Epub 2008 Dec 10."}

{"pubmed_id": "17210123.0", "paper": "Inhibition of HIV-1 infection by synthetic peptides derived CCR5 fragments.", "authors": "Imai M, Baranyi L, Okada N, Okada H.", "reference": "Biochem Biophys Res Commun. 2007 Feb 23;353(4):851-6. Epub 2006 Dec 21."}

{"pubmed_id": "17210123.0", "paper": "Inhibition of HIV-1 infection by synthetic peptides derived CCR5 fragments.", "authors": "Imai M, Baranyi L, Okada N, Okada H.", "reference": "Biochem Biophys Res Commun. 2007 Feb 23;353(4):851-6. Epub 2006 Dec 21."}

{"pubmed_id": "17640899.0", "paper": "Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.", "authors": "Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.", "reference": "Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7. Epub 2007 Jul 19."}

{"pubmed_id": "17640899.0", "paper": "Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.", "authors": "Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.", "reference": "Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7. Epub 2007 Jul 19."}

{"pubmed_id": "11222732.0", "paper": "Membrane-anchored peptide inhibits human immunodeficiency virus entry.", "authors": "Hildinger M, Dittmar MT, Schult-Dietrich P, Fehse B, Schnierle BS, Thaler S, Stiegler G, Welker R, von Laer D.", "reference": "J Virol. 2001 Mar;75(6):3038-42."}

{"pubmed_id": "11222732.0", "paper": "Membrane-anchored peptide inhibits human immunodeficiency virus entry.", "authors": "Hildinger M, Dittmar MT, Schult-Dietrich P, Fehse B, Schnierle BS, Thaler S, Stiegler G, Welker R, von Laer D.", "reference": "J Virol. 2001 Mar;75(6):3038-42."}

-

--PMID 30716118

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 17640899

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 19114674

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 19073606

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 27795416

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 31932193

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 31805154

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 31228294

Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK

Proc Natl Acad Sci U S A2007PMID 30867304

-

--PMID 18197613

-

--PMID 15334539

[{"text": "drugbank.com", "url": "https://go.drugbank.com/drugs/DB00109", "markdown": "[drugbank.com](https://go.drugbank.com/drugs/DB00109)"}, {"text": "nih.gov", "url": "https://pubmed.ncbi.nlm.nih.gov/15656696/", "markdown": "[nih.gov](https://pubmed.ncbi.nlm.nih.gov/15656696/)"}, {"text": "europa.eu", "url": "https://www.ema.europa.eu/en/documents/scientific-discussion/fuzeon-epar-scientific-discussion_en.pdf", "markdown": "[europa.eu](https://www.ema.europa.eu/en/documents/scientific-discus

[{"text": "drugbank.com", "url": "https://go.drugbank.com/drugs/DB00109", "markdown": "[drugbank.com](https://go.drugbank.com/drugs/DB00109)"}, {"text": "nih.gov", "url": "https://pubmed.ncbi.nlm.nih.gov/15656696/", "markdown": "[nih.gov](https://pubmed.ncbi.nlm.nih.gov/15656696/)"}, {"text": "europa.eu", "url": "https://www.ema.europa.eu/en/documents/scientific-discussion/fuzeon-epar-scientific-discussion_en.pdf", "markdown": "[europa.eu](https://www.ema.europa.eu/en/documents/scientific-discus

-

--PMID 19949052

IP evidence

Patents (1)

US 20100261876

dramp

Audit surface

Raw annotations and release metadata

Integrated record last updated: 2026-04-15T00:59:13.225027+00:00

Modification summary

No structured modification annotations are available for this record.

ADMET

{
  "toxicity": [
    {
      "unit": "µM",
      "value": "187.28",
      "source_db": "dbaasp",
      "assay_method": "50% Cytotoxicity",
      "toxicity_type": "Cytotoxic",
      "target_cellline": "Human embryonic kidney HEK293T cells"
    },
    {
      "unit": "µM",
      "value": "75.24",
      "source_db": "dbaasp",
      "assay_method": "50% Cytotoxicity",
      "toxicity_type": "Cytotoxic",
      "target_cellline": "Human PBMC"
    }
  ]
}

Source metadata

[
  {
    "source_db": "avpdb",
    "organism_name": "Unknown"
  },
  {
    "source_db": "hipdb",
    "organism_name": "Unknown"
  },
  {
    "source_db": "camp",
    "organism_name": "Unknown"
  },
  {
    "source_db": "dbaasp",
    "organism_name": "Unknown"
  },
  {
    "source_db": "dramp",
    "organism_name": "Unknown"
  },
  {
    "source_db": "peptherdia",
    "organism_name": "Unknown"
  },
  {
    "source_db": "satpdb",
    "organism_name": "Unknown"
  },
  {
    "source_db": "thpdb",
    "organism_name": "Unknown"
  },
  {
    "source_db": "topicalpdb",
    "organism_name": "Unknown"
  }
]

Structure metadata

{
  "source_db": "satpdb",
  "dssp_states": "CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC"
}

Clinical trials

[
  {
    "status": "Therapeutic",
    "drug_name": "Enfuvirtide",
    "source_db": "peptherdia",
    "indication": "Antiretroviral drug used in combination therapy for the treatment of HIV-1/AIDS.",
    "approval_year": 2003,
    "approval_agency": "FDA-EMA",
    "administration_route": "SC"
  }
]

Approved drug annotations

{
  "status": "Therapeutic",
  "drug_name": "Enfuvirtide",
  "source_db": "peptherdia",
  "indication": "Antiretroviral drug used in combination therapy for the treatment of HIV-1/AIDS.",
  "approval_year": 2003,
  "approval_agency": "FDA-EMA",
  "administration_route": "SC"
}