Veterinary Sciences · 2025
Sequence evidence
FKCRRWQWRMKKLGAPSITCVRRAFGGGSSVDGKEDLIWKLLSKAQEKFGKNKSR
Section 2.8: the sequence of LFCA is 5′-TTTAAATGCCGTCGTTGGCAATGGCGCATGAAGAAGTTGGGCGCTCCGAGTATTACCTGCGTTCGCCGCGCTTTTGGCGGTGGCTCCAGTGTTGATGGCAAAGAAGATTTGATTTGGAAATTGTTGAGTAAAGCTCAAGAAAAATTTGGCAAAAATAAAAGTCGTTAA-3′
Experimental observations
After treatment with LFCA of different dilutions, the cell survival rate was about 100% (Figure 1), and LFCA at concentrations of less than 400 μg/mL had no toxicity to cells.
After treatment with LFCA of different dilutions, the cell survival rate was about 100% (Figure 1), and LFCA at concentrations of less than 400 μg/mL had no toxicity to cells.
The inhibition rate could reach 94.9% after pretreatment before SVA infection.
The inhibition rates of the virus in the stages of adsorption, invasion, and replication were 91.2%, 75.6%, and 65.9%, respectively.
The inhibition rates of the virus in the stages of adsorption, invasion, and replication were 91.2%, 75.6%, and 65.9%, respectively.
The inhibition rates of the virus in the stages of adsorption, invasion, and replication were 91.2%, 75.6%, and 65.9%, respectively.
The highest inhibition rate of FMDV replication was observed in LFCA-treated cells (74.3%).
The inhibition effect of the adsorption stage was second only to that of the replication stage, and the inhibition rate was 63.4%.
The 50% inhibitory concentration of LFCA against SVA was determined to be 8.96 μg/mL.
Data analysis revealed that the 50% inhibitory concentration (IC50) of LFCA against FMDV was 203.9 μg/mL.
The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
LFCA demonstrated an inhibition rate of 66.3% against FMDV at 400 μg/mL; this rate decreased with lower concentrations and was absent at 50 μg/mL.
LFCA demonstrated an inhibition rate of 66.3% against FMDV at 400 μg/mL; this rate decreased with lower concentrations and was absent at 50 μg/mL.
Local peptide labels such as P1, PEP1, or peptide 1 are grouped only within this paper and are not assumed to represent the same molecule across publications.
