ProForma 2.0
validated simple linear
FKCRRWQWRMKKLGAPSITCVRRAFGGGSSVDGKEDLIWKLLSKAQEKFGKNKSR
Back to Primary literature
Primary-literature peptidehigh evidence PepDiana evidence grade for a literature-derived identity; Medium indicates retained review flags, while High has no unresolved review flag.
PEPDIA-PLP-000726
LFCA
Aliases: LFCA
Normalized sequence
FKCRRWQWRMKKLGAPSITCVRRAFGGGSSVDGKEDLIWKLLSKAQEKFGKNKSR
55 amino acids
Release PepDiana-V1-20260620
18
Activity records
1
Source papers
18
Positive
0
Negative / threshold
Versioned scientific descriptors
Physicochemical properties and standard representations
Reported properties
No separate physicochemical property was reported in the primary-literature identity record. PepDiana release values are shown as computed properties.
Computed properties
physchem-20260620Molecular weight
6371.4316 Da
Molecular formula
C284H460N88O73S3
Theoretical pI
10.772
Net charge at pH 7
10.7391
GRAVY
-0.8127
Instability index
56.3109
Aromaticity
0.1091
Topological polar surface area
2678.73 Ų
cLogP
-25.7985
Hydrogen-bond donors
100
Hydrogen-bond acceptors
87
Rotatable bonds
223
Method: PepDiana sequence/structure descriptor pipeline
Tool: Biopython+RDKit · Biopython 1.85; RDKit 2024.09.6
Calculated: 2026-06-20T11:01:38.358971+00:00
Assumptions: ph=7; termini=free N-terminus and free C-terminus for simple linear peptides; stereochemistry=standard L-amino acids; smiles_length_limit=200
Sequence representations
HELM 2.0
validated simple linear
PEPTIDE1{F.K.C.R.R.W.Q.W.R.M.K.K.L.G.A.P.S.I.T.C.V.R.R.A.F.G.G.G.S.S.V.D.G.K.E.D.L.I.W.K.L.L.S.K.A.Q.E.K.F.G.K.N.K.S.R}$$$$V2.0
Canonical SMILES
validated
CCC(C)C(NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCCCN)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)C(NC(=O)C(CO)NC(=O)C(CO)NC(=O)CNC(=O)CNC(=O)CNC(=O)C(Cc1ccccc1)NC(=O)C(C)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(NC(=O)C(CS)NC(=O)C(NC(=O)C(NC(=O)C(CO)NC(=O)C1CCCN1C(=O)C(C)NC(=O)CNC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(CCSC)NC(=O)C(CCCNC(=N)N)NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)C(CCC(N)=O)NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(CS)NC(=O)C(CCCCN)NC(=O)C(N)Cc1ccccc1)C(C)CC)C(C)O)C(C)C)C(C)C)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CCCCN)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(=O)O)C(=O)NC(CCCCN)C(=O)NC(Cc1ccccc1)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NC(CCCCN)C(=O)NC(CO)C(=O)NC(CCCNC(=N)N)C(=O)O
Isomeric SMILES
validated
CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)Cc1ccccc1)[C@@H](C)CC)[C@@H](C)O)C(C)C)C(C)C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O
Paper-level observations
Experimental evidence grouped by activity
Antiviral 16 records
PMC11945493
16 observationsAntiviralGeneral AntiviralPositive observation
Record detail The inhibition rate could reach 94.9% after pretreatment before SVA infection.
- Measure
- percent_inhibition
- Value
- 94.9%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of the virus in the stages of adsorption, invasion, and replication were 91.2%, 75.6%, and 65.9%, respectively.
- Measure
- percent_inhibition
- Value
- 91.2%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of the virus in the stages of adsorption, invasion, and replication were 91.2%, 75.6%, and 65.9%, respectively.
- Measure
- percent_inhibition
- Value
- 75.6%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of the virus in the stages of adsorption, invasion, and replication were 91.2%, 75.6%, and 65.9%, respectively.
- Measure
- percent_inhibition
- Value
- 65.9%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The highest inhibition rate of FMDV replication was observed in LFCA-treated cells (74.3%).
- Measure
- percent_inhibition
- Value
- 74.3%
- Target
- PK-15
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition effect of the adsorption stage was second only to that of the replication stage, and the inhibition rate was 63.4%.
- Measure
- percent_inhibition
- Value
- 63.4%
- Target
- PK-15
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The 50% inhibitory concentration of LFCA against SVA was determined to be 8.96 μg/mL.
- Measure
- other
- Value
- 8.96 μg/mL
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail Data analysis revealed that the 50% inhibitory concentration (IC50) of LFCA against FMDV was 203.9 μg/mL.
- Measure
- other
- Value
- 203.9 μg/mL
- Target
- PK-15
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
- Measure
- percent_inhibition
- Value
- 41.8%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
- Measure
- percent_inhibition
- Value
- 57.3%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
- Measure
- percent_inhibition
- Value
- 80.3%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
- Measure
- percent_inhibition
- Value
- 89.6%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
- Measure
- percent_inhibition
- Value
- 94.5%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail The inhibition rates of SVA by LFCA were 41.8%, 57.3%, 80.3%, 89.6%, 94.5%, and 96.1%.
- Measure
- percent_inhibition
- Value
- 96.1%
- Target
- BHK-21
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail LFCA demonstrated an inhibition rate of 66.3% against FMDV at 400 μg/mL; this rate decreased with lower concentrations and was absent at 50 μg/mL.
- Measure
- percent_inhibition
- Value
- 66.3%
- Target
- PK-15
- Assay
- Not reported by source
AntiviralGeneral AntiviralPositive observation
Record detail LFCA demonstrated an inhibition rate of 66.3% against FMDV at 400 μg/mL; this rate decreased with lower concentrations and was absent at 50 μg/mL.
- Measure
- percent_inhibition
- Value
- absent
- Target
- PK-15
- Assay
- Not reported by source
Toxicity 2 records
PMC11945493
2 observationsToxicityCytotoxicPositive observation
Record detail After treatment with LFCA of different dilutions, the cell survival rate was about 100% (Figure 1), and LFCA at concentrations of less than 400 μg/mL had no toxicity to cells.
- Measure
- cell_viability
- Value
- about 100%
- Target
- BHK-21
- Assay
- Not reported by source
ToxicityCytotoxicPositive observation
Record detail After treatment with LFCA of different dilutions, the cell survival rate was about 100% (Figure 1), and LFCA at concentrations of less than 400 μg/mL had no toxicity to cells.
- Measure
- cell_viability
- Value
- about 100%
- Target
- PK-15
- Assay
- Not reported by source
Citation and release provenance
Cite this identity as PepDiana record PEPDIA-PLP-000726, release PepDiana-V1-20260620. Experimental observations retain their paper, mention, and activity-record identifiers.
Record updated: 2026-06-22T07:14:26.229247+00:00