ProForma 2.0
validated simple linear
VGECVRGRCPSGACCSQWGYCGKGPKYCGR
Back to Primary literature
Primary-literature peptidemedium evidence PepDiana evidence grade for a literature-derived identity; Medium indicates retained review flags, while High has no unresolved review flag.
PEPDIA-PLP-002970
mAc-AMP2
Aliases: mAc-AMP2
Normalized sequence
VGECVRGRCPSGACCSQWGYCGKGPKYCGR
30 amino acids
Release PepDiana-V1-20260620
53
Activity records
1
Source papers
46
Positive
7
Negative / threshold
Versioned scientific descriptors
Physicochemical properties and standard representations
Reported properties
No separate physicochemical property was reported in the primary-literature identity record. PepDiana release values are shown as computed properties.
Computed properties
physchem-20260620Molecular weight
3168.6579 Da
Molecular formula
C130H203N43O38S6
Theoretical pI
8.9195
Net charge at pH 7
3.6734
GRAVY
-0.4733
Instability index
32.7567
Aromaticity
0.1
Topological polar surface area
1304.48 Ų
cLogP
-17.4163
Hydrogen-bond donors
53
Hydrogen-bond acceptors
48
Rotatable bonds
99
Method: PepDiana sequence/structure descriptor pipeline
Tool: Biopython+RDKit · Biopython 1.85; RDKit 2024.09.6
Calculated: 2026-06-20T11:01:38.358971+00:00
Assumptions: ph=7; termini=free N-terminus and free C-terminus for simple linear peptides; stereochemistry=standard L-amino acids; smiles_length_limit=200
Sequence representations
HELM 2.0
validated simple linear
PEPTIDE1{V.G.E.C.V.R.G.R.C.P.S.G.A.C.C.S.Q.W.G.Y.C.G.K.G.P.K.Y.C.G.R}$$$$V2.0
Canonical SMILES
validated
CC(NC(=O)CNC(=O)C(CO)NC(=O)C1CCCN1C(=O)C(CS)NC(=O)C(CCCNC(=N)N)NC(=O)CNC(=O)C(CCCNC(=N)N)NC(=O)C(NC(=O)C(CS)NC(=O)C(CCC(=O)O)NC(=O)CNC(=O)C(N)C(C)C)C(C)C)C(=O)NC(CS)C(=O)NC(CS)C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NCC(=O)NC(Cc1ccc(O)cc1)C(=O)NC(CS)C(=O)NCC(=O)NC(CCCCN)C(=O)NCC(=O)N1CCCC1C(=O)NC(CCCCN)C(=O)NC(Cc1ccc(O)cc1)C(=O)NC(CS)C(=O)NCC(=O)NC(CCCNC(=N)N)C(=O)O
Isomeric SMILES
validated
CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C
Paper-level observations
Experimental evidence grouped by activity
Antimicrobial 50 records
PMC12655060
50 observationsAntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans ATCC 18804 MIC 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans ATCC 18804 MIC50 0.19–0.39 µM.
- Measure
- MIC
- Value
- 0.19–0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans ATCC 18804 MFC 0.78 µM.
- Measure
- other
- Value
- 0.78 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans ATCC 10231 MIC 0.78 µM.
- Measure
- MIC
- Value
- 0.78 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans ATCC 10231 MIC50 0.19–0.39 µM.
- Measure
- MIC
- Value
- 0.19–0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalNegative / threshold
Record detail Table 1: C. albicans ATCC 10231 MFC >6.25 µM.
- Measure
- other
- Value
- >6.25 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAnti-BiofilmPositive observation
Record detail Table 1: C. albicans ATCC 10231 BIC50 25–50 µM.
- Measure
- other
- Value
- 25–50 (BIC50)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAnti-BiofilmPositive observation
Record detail Table 1: C. albicans ATCC 10231 BIC 50 µM.
- Measure
- other
- Value
- 50 (BIC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans 8.2 MIC 0.78 µM.
- Measure
- MIC
- Value
- 0.78 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans 8.2 MIC50 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalNegative / threshold
Record detail Table 1: C. albicans 8.2 MFC >6.25 µM.
- Measure
- other
- Value
- >6.25 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAnti-BiofilmPositive observation
Record detail Table 1: C. albicans 8.2 BIC50 6.25–12.5 µM.
- Measure
- other
- Value
- 6.25–12.5 (BIC50)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAnti-BiofilmPositive observation
Record detail Table 1: C. albicans 8.2 BIC 12.5 µM.
- Measure
- other
- Value
- 12.5 (BIC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans 9.1 MIC 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans 9.1 MIC50 0.19–0.39 µM.
- Measure
- MIC
- Value
- 0.19–0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. albicans 9.1 MFC 6.25 µM.
- Measure
- other
- Value
- 6.25 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAnti-BiofilmPositive observation
Record detail Table 1: C. albicans 9.1 BIC50 6.25–12.5 µM.
- Measure
- other
- Value
- 6.25–12.5 (BIC50)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAnti-BiofilmPositive observation
Record detail Table 1: C. albicans 9.1 BIC 50 µM.
- Measure
- other
- Value
- 50 (BIC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. tropicalis v13a4/2 MIC 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida tropicalis
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. tropicalis v13a4/2 MIC50 0.09–0.19 µM.
- Measure
- MIC
- Value
- 0.09–0.19 µM
- Target
- Candida tropicalis
- Assay
- Not reported by source
AntimicrobialAntifungalNegative / threshold
Record detail Table 1: C. tropicalis v13a4/2 MFC >12.5 µM.
- Measure
- other
- Value
- >12.5 (MFC)
- Target
- Candida tropicalis
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. krusei 225/2 MIC 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida krusei
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. krusei 225/2 MIC50 0.09–0.19 µM.
- Measure
- MIC
- Value
- 0.09–0.19 µM
- Target
- Candida krusei
- Assay
- Not reported by source
AntimicrobialAntifungalNegative / threshold
Record detail Table 1: C. krusei 225/2 MFC >12.5 µM.
- Measure
- other
- Value
- >12.5 (MFC)
- Target
- Candida krusei
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. glabrata 252/2 MIC 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida glabrata
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 1: C. glabrata 252/2 MIC50 0.09–0.19 µM.
- Measure
- MIC
- Value
- 0.09–0.19 µM
- Target
- Candida glabrata
- Assay
- Not reported by source
AntimicrobialAntifungalNegative / threshold
Record detail Table 1: C. glabrata 252/2 MFC >12.5 µM.
- Measure
- other
- Value
- >12.5 (MFC)
- Target
- Candida glabrata
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 150 mM NaCl MIC 6.25 µM.
- Measure
- MIC
- Value
- 6.25 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 150 mM NaCl MFC 6.25 µM.
- Measure
- other
- Value
- 6.25 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 1.25 mM CaCl2 MIC 3.13 µM.
- Measure
- MIC
- Value
- 3.13 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 1.25 mM CaCl2 MFC 6.25 µM.
- Measure
- other
- Value
- 6.25 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 1.25 mM MgCl2 MIC 1.56 µM.
- Measure
- MIC
- Value
- 1.56 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 1.25 mM MgCl2 MFC 3.13 µM.
- Measure
- other
- Value
- 3.13 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 10% FBS MIC 0.78 µM.
- Measure
- MIC
- Value
- 0.78 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: 10% FBS MFC 0.78 µM.
- Measure
- other
- Value
- 0.78 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: RPMI-1640 MIC 50 µM.
- Measure
- MIC
- Value
- 50 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalNegative / threshold
Record detail Table 2: RPMI-1640 MFC >50 µM.
- Measure
- other
- Value
- >50 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: pH 5.0 MIC 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: pH 5.0 MFC 0.78 µM.
- Measure
- other
- Value
- 0.78 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: pH 7.0 MIC 0.39 µM.
- Measure
- MIC
- Value
- 0.39 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 2: pH 7.0 MFC 0.78 µM.
- Measure
- other
- Value
- 0.78 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 4: mAc-AMP2 with 3.25 µM GSH MIC 0.78 µM.
- Measure
- MIC
- Value
- 0.78 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 4: mAc-AMP2 with 3.25 µM GSH MFC 1.56 µM.
- Measure
- other
- Value
- 1.56 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalNegative / threshold
Record detail Table 4: mAc-AMP2 after DTT MIC >12.5 µM.
- Measure
- MIC
- Value
- >12.5 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 4: mAc-AMP2 after 99°C MIC 0.78 µM.
- Measure
- MIC
- Value
- 0.78 µM
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Table 4: mAc-AMP2 after 99°C MFC 3.13 µM.
- Measure
- other
- Value
- 3.13 (MFC)
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Section 3.3: mAc-AMP2 inhibited adhesion of the clinical isolate 8.2 by 42% at concentration of 1.56 µM.
- Measure
- percent_inhibition
- Value
- 42%
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Section 3.3: mAc-AMP2 inhibited adhesion of the clinical isolate 8.2 by 45% at concentration of 3.13 µM.
- Measure
- percent_inhibition
- Value
- 45%
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Section 3.3: mAc-AMP2 inhibited adhesion of the clinical isolate 8.2 by 81% at concentration of 6.25 µM.
- Measure
- percent_inhibition
- Value
- 81%
- Target
- Candida albicans
- Assay
- Not reported by source
AntimicrobialAntifungalPositive observation
Record detail Section 3.3: mAc-AMP2 inhibited adhesion of the clinical isolate 8.2 by 96% at concentration of 12.5 µM.
- Measure
- percent_inhibition
- Value
- 96%
- Target
- Candida albicans
- Assay
- Not reported by source
Toxicity 3 records
PMC12655060
3 observationsToxicityHemolyticPositive observation
Record detail Section 3.7: mAc-AMP2 did not cause lysis of erythrocytes after incubation for 2 h even at the concentration of 100 µM.
- Measure
- hemolysis
- Value
- ~0%
- Target
- Homo sapiens
- Assay
- Not reported by source
ToxicityCytotoxicPositive observation
Record detail Section 3.7: cell viability of approximately 100% was observed even at the peptide concentration of 100 µM in the case of the Caco-2 cell monolayer.
- Measure
- cell_viability
- Value
- ~100%
- Target
- Caco-2
- Assay
- Not reported by source
ToxicityCytotoxicPositive observation
Record detail Section 3.7: The absence of cytotoxic effects was also shown for PBMCs at a mAc-AMP2 concentration of 25 µM.
- Measure
- cell_viability
- Value
- ~100%
- Target
- PBMC
- Assay
- Not reported by source
Citation and release provenance
Cite this identity as PepDiana record PEPDIA-PLP-002970, release PepDiana-V1-20260620. Experimental observations retain their paper, mention, and activity-record identifiers.
Record updated: 2026-06-22T07:14:26.229247+00:00