ProForma 2.0
validated simple linear
VTDFGVFVEIGGGGSRQIKIWFQNRRMKWKK
Back to Primary literature
Primary-literature peptidehigh evidence PepDiana evidence grade for a literature-derived identity; Medium indicates retained review flags, while High has no unresolved review flag.
PEPDIA-PLP-003097
V31KT
Aliases: V31KT
Normalized sequence
VTDFGVFVEIGGGGSRQIKIWFQNRRMKWKK
31 amino acids
Release PepDiana-V1-20260620
36
Activity records
1
Source papers
20
Positive
16
Negative / threshold
Versioned scientific descriptors
Physicochemical properties and standard representations
Reported properties
No separate physicochemical property was reported in the primary-literature identity record. PepDiana release values are shown as computed properties.
Computed properties
physchem-20260620Molecular weight
3669.2647 Da
Molecular formula
C169H263N49O41S
Theoretical pI
11.0689
Net charge at pH 7
4.7339
GRAVY
-0.5
Instability index
48.0871
Aromaticity
0.1613
Topological polar surface area
1502.01 Ų
cLogP
-11.4404
Hydrogen-bond donors
54
Hydrogen-bond acceptors
47
Rotatable bonds
126
Method: PepDiana sequence/structure descriptor pipeline
Tool: Biopython+RDKit · Biopython 1.85; RDKit 2024.09.6
Calculated: 2026-06-20T11:01:38.358971+00:00
Assumptions: ph=7; termini=free N-terminus and free C-terminus for simple linear peptides; stereochemistry=standard L-amino acids; smiles_length_limit=200
Sequence representations
HELM 2.0
validated simple linear
PEPTIDE1{V.T.D.F.G.V.F.V.E.I.G.G.G.G.S.R.Q.I.K.I.W.F.Q.N.R.R.M.K.W.K.K}$$$$V2.0
Canonical SMILES
validated
CCC(C)C(NC(=O)C(CCC(=O)O)NC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(NC(=O)CNC(=O)C(Cc1ccccc1)NC(=O)C(CC(=O)O)NC(=O)C(NC(=O)C(N)C(C)C)C(C)O)C(C)C)C(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NC(CO)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCC(N)=O)C(=O)NC(C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(Cc1ccccc1)C(=O)NC(CCC(N)=O)C(=O)NC(CC(N)=O)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCSC)C(=O)NC(CCCCN)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O)C(C)CC)C(C)CC
Isomeric SMILES
validated
CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(C)C)C(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)CC)[C@@H](C)CC
Paper-level observations
Experimental evidence grouped by activity
Unknown 36 records
PMC12470154
36 observationsUnknownPositive observation
Record detail Table 1: V31K^T against MRSA (SA 180-F Strain) shows ↓ (1 mg/mL).
- Measure
- qualitative
- Value
- ↓ (1 mg/mL)
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 1: V31K^T against S. aureus (129B Strain) shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 1: V31K^T against E. coli (MG1655 Strain) shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 1: V31K^T against P. aeruginosa (2943 Strain) shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 1 mg/mL against MRSA shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.1 mg/mL against MRSA shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.01 mg/mL against MRSA shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.001 mg/mL against MRSA shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 1 mg/mL against S. aureus 129B shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.1 mg/mL against S. aureus 129B shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.01 mg/mL against S. aureus 129B shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.001 mg/mL against S. aureus 129B shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 1 mg/mL against E. coli MG1655 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.1 mg/mL against E. coli MG1655 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.01 mg/mL against E. coli MG1655 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.001 mg/mL against E. coli MG1655 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 1 mg/mL against P. aeruginosa 2943 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.1 mg/mL against P. aeruginosa 2943 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.01 mg/mL against P. aeruginosa 2943 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownNegative / threshold
Record detail Table 2: V31K^T at 0.001 mg/mL against P. aeruginosa 2943 shows − (no inhibition zone).
- Measure
- qualitative
- Value
- −
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against MRSA early biofilm after crystal violet staining shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against S. aureus 129B early biofilm after crystal violet staining shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against E. coli MG1655 early biofilm after crystal violet staining shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against P. aeruginosa 2943 early biofilm after crystal violet staining shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against MRSA early biofilm after MTT assay shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against S. aureus 129B early biofilm after MTT assay shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against E. coli MG1655 early biofilm after MTT assay shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 3: V31K^T against P. aeruginosa 2943 early biofilm after MTT assay shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against MRSA mature biofilm after crystal violet staining shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against S. aureus 129B mature biofilm after crystal violet staining shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against E. coli MG1655 mature biofilm after crystal violet staining shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against P. aeruginosa 2943 mature biofilm after crystal violet staining shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against MRSA mature biofilm after MTT assay shows ↓ (0.01 mg/mL).
- Measure
- qualitative
- Value
- ↓ (0.01 mg/mL)
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against S. aureus 129B mature biofilm after MTT assay shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Staphylococcus aureus
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against E. coli MG1655 mature biofilm after MTT assay shows − (no decrease).
- Measure
- qualitative
- Value
- −
- Target
- Escherichia coli
- Assay
- Not reported by source
UnknownPositive observation
Record detail Table 4: V31K^T against P. aeruginosa 2943 mature biofilm after MTT assay shows ↑ (reverse effect).
- Measure
- qualitative
- Value
- ↑
- Target
- Pseudomonas aeruginosa
- Assay
- Not reported by source
Citation and release provenance
Cite this identity as PepDiana record PEPDIA-PLP-003097, release PepDiana-V1-20260620. Experimental observations retain their paper, mention, and activity-record identifiers.
Record updated: 2026-06-22T07:14:26.229247+00:00